General Information

  • ID:  hor005652
  • Uniprot ID:  P51918
  • Protein name:  Gonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Haplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Synthesized in preoptic neurons and is transported to the pituitary in the preoptic-hypophyseal axons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Haplochromis (genus), Haplochromini (tribe), Pseudocrenilabrinae (subfamily), African cichlids, Cichlidae (family), Cichliformes (order), Cichlomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLSPG
  • Length:  10
  • Propeptide:  MAAKILALWLLLAGTVFPQGCCQHWSYGLSPGGKRDLDNFSDTLGNMVEEFPRVEAPCSVFGCAEESPFAKMYRVKGLLASVAERENGHRTFKK
  • Signal peptide:  MAAKILALWLLLAGTVFPQGCC
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins. May be responsible for the regulation of the hypothalamic-pituitary-gonadal axis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51918-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005652_AF2.pdbhor005652_ESM.pdb

Physical Information

Mass: 129192 Formula: C52H70N14O15
Absent amino acids: ACDEFIKMNRTV Common amino acids: GS
pI: 7.54 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -91 Boman Index: -801
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 4157 Extinction Coefficient cystines: 6990
Absorbance 280nm: 776.67

Literature

  • PubMed ID:  7644702
  • Title:  Primary structure of solitary form of gonadotropin-releasing hormone (GnRH) in cichlid pituitary; three forms of GnRH in brain of cichlid and pumpkinseed fish.